RetrogeneDB ID: | retro_tgut_20 | ||
Retrocopy location | Organism: | Zebrafinch (Taeniopygia guttata) | |
| Coordinates: | 2:90832051..90832276(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | DNAJC15 | ||
| Ensembl ID: | ENSTGUG00000012364 | ||
| Aliases: | None | ||
| Description: | DnaJ (Hsp40) homolog, subfamily C, member 15 [Source:HGNC Symbol;Acc:20325] |
| Percent Identity: | 57.33 % |
| Parental protein coverage: | 50.68 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | ITEAAKRISTSSLSSYYKGGFEQKMSRREASLILGVSPSAGKDKIRTAHRKIMILNHPDKGGSPYLATKI |
| .........T.S.SSY.KGGFEQK.S...A.L.L.VSPSA.KD..RTA.R...IL.HPDKGGSP.LA.KI | |
| Retrocopy | LVRTVSTFGTCSISSYCKGGFEQKTSTQAACLLLSVSPSADKDQVRTADRISRILKHPDKGGSPDLAAKI |
| Parental | NEAKD |
| ...KD | |
| Retrocopy | Y*TKD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |