RetrogeneDB ID: | retro_etel_930 | ||
Retrocopy location | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
| Coordinates: | scaffold_185841:494..899(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSETEG00000020374 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | FAM192A | ||
| Ensembl ID: | ENSETEG00000014379 | ||
| Aliases: | None | ||
| Description: | family with sequence similarity 192, member A [Source:HGNC Symbol;Acc:29856] |
| Percent Identity: | 87.41 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | KLGMSAGNKKDVEKKPAVKPIEGKTKLSQAKLLAGAVKHKSSESGNSAKRLKPDPDPDDKNQEAPPCVSL |
| KLG.SA.NKKDVEKKPAVKPIEGKTKLSQAKLLAGAVKHKSSESGNS.KRLKPDPDPDDKNQEAPPCVSL | |
| Retrocopy | KLGISAENKKDVEKKPAVKPIEGKTKLSQAKLLAGAVKHKSSESGNSVKRLKPDPDPDDKNQEAPPCVSL |
| Parental | -GSPSLSGPSLHCPSAAVCISILPGLGAYSGSSDSESSSDSEGTINATGKIVSSIFRTNTFLEAP |
| ...P....P....P.AAVCI.IL.GLGAYSGSSDSESSSDSEGTINATGKIVSSIFRTNTFLEAP | |
| Retrocopy | PRKPFPERPLPPLPLAAVCIGILLGLGAYSGSSDSESSSDSEGTINATGKIVSSIFRTNTFLEAP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000002242 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000001392 | 1 retrocopy | |
| Equus caballus | ENSECAG00000009324 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000014379 | 1 retrocopy |
retro_etel_930 ,
|
| Homo sapiens | ENSG00000172775 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000003938 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000013492 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000031774 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000002716 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000006909 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000007382 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000008148 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000013300 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000012791 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000005973 | 1 retrocopy |