RetrogeneDB ID: | retro_fcat_1167 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
Coordinates: | C1:34476113..34476341(-) | ||
Located in intron of: | ENSFCAG00000009972 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | VAMP4 | ||
Ensembl ID: | ENSFCAG00000013371 | ||
Aliases: | None | ||
Description: | vesicle-associated membrane protein 4 [Source:HGNC Symbol;Acc:12645] |
Percent Identity: | 80.26 % |
Parental protein coverage: | 53.9 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRNDKIKHVQNQVDEVIDVMQEN |
MPPKFK.HLNDDDVTGSVKSE.RNLLE.DSDEEE.FFL.GPS.PRF.PR.D.IK..QNQV.EVIDVMQEN | |
Retrocopy | MPPKFKCHLNDDDVTGSVKSEGRNLLEEDSDEEEYFFLKGPSEPRFRPRSDTIKYIQNQVAEVIDVMQEN |
Parental | ITKVIE |
.TK..E | |
Retrocopy | STKIKE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 21 .46 RPM |
SRP017611_kidney | 0 .00 RPM | 10 .31 RPM |
SRP017611_liver | 0 .00 RPM | 6 .77 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000016956 | 1 retrocopy | |
Felis catus | ENSFCAG00000013371 | 1 retrocopy |
retro_fcat_1167 ,
|
Macropus eugenii | ENSMEUG00000011226 | 13 retrocopies | |
Monodelphis domestica | ENSMODG00000003811 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000015609 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000015967 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000026745 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000014342 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000017179 | 2 retrocopies | |
Vicugna pacos | ENSVPAG00000007424 | 1 retrocopy |