RetrogeneDB ID: | retro_fcat_1269 | ||
Retrocopy location | Organism: | Cat (Felis catus) | |
| Coordinates: | C2:53893657..53893892(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PIGP | ||
| Ensembl ID: | ENSFCAG00000028400 | ||
| Aliases: | None | ||
| Description: | phosphatidylinositol glycan anchor biosynthesis, class P [Source:HGNC Symbol;Acc:3046] |
| Percent Identity: | 72.5 % |
| Parental protein coverage: | 53.02 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | PETWLNSLGLTYWPQKYWAIALPVYLLITIVIGYVLLFGINMMSTSPLNSIHTITDNYA-KNQQRKNYQE |
| P..WLNS.G.TYWPQKYWA.ALPV.L.ITI.I.YV.L...N..STSPLNSIHTITDNY..KNQQ.K.YQE | |
| Retrocopy | PDSWLNS*GSTYWPQKYWAVALPVILFITIGIDYVSLIRTN-ISTSPLNSIHTITDNYV>KNQQ*KKYQE |
| Parental | EAIPALRDIP |
| E.I.ALRD.P | |
| Retrocopy | EVIRALRDSP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 13 .31 RPM |
| SRP017611_kidney | 0 .00 RPM | 12 .99 RPM |
| SRP017611_liver | 0 .00 RPM | 7 .78 RPM |