RetrogeneDB ID: | retro_ggor_1187 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 15:22598787..22599210(-) | ||
Located in intron of: | ENSGGOG00000017045 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PAR14 | ||
Ensembl ID: | ENSGGOG00000016008 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 95.04 % |
Parental protein coverage: | 90.38 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | QFRVEQQASKMPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKHGKIMEAMEKLKS |
.FRV.QQASKMPPKGKSGSGKAGKGGAASGSDSADK.AQGPKGGGNAVKVRHIL.EKHGKIMEAMEKLKS | |
Retrocopy | EFRVQQQASKMPPKGKSGSGKAGKGGAASGSDSADKRAQGPKGGGNAVKVRHILWEKHGKIMEAMEKLKS |
Parental | GMRFNEVATQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGR |
GMRFNEVATQYSEDKARQGG.LGWMTRGSMVGPFQEAAFALP.SGMDKPVFTDP.VKTKFGYHIIMVEGR | |
Retrocopy | GMRFNEVATQYSEDKARQGGILGWMTRGSMVGPFQEAAFALPISGMDKPVFTDPAVKTKFGYHIIMVEGR |
Parental | K |
K | |
Retrocopy | K |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .29 RPM | 13 .14 RPM |
SRP007412_cerebellum | 0 .12 RPM | 8 .51 RPM |
SRP007412_heart | 0 .06 RPM | 5 .94 RPM |
SRP007412_kidney | 0 .04 RPM | 18 .48 RPM |
SRP007412_liver | 0 .03 RPM | 9 .65 RPM |
SRP007412_testis | 0 .00 RPM | 6 .11 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1562 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000005801 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000032230 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000004992 | 10 retrocopies | |
Cavia porcellus | ENSCPOG00000011401 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000006985 | 2 retrocopies | |
Felis catus | ENSFCAG00000012036 | 5 retrocopies | |
Homo sapiens | ENSG00000102309 | 3 retrocopies | |
Gorilla gorilla | ENSGGOG00000016008 | 4 retrocopies | |
Loxodonta africana | ENSLAFG00000018261 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000003611 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000001640 | 4 retrocopies | |
Myotis lucifugus | ENSMLUG00000012073 | 2 retrocopies | |
Mustela putorius furo | ENSMPUG00000005287 | 3 retrocopies | |
Mus musculus | ENSMUSG00000079480 | 8 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000008715 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000020460 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000050051 | 6 retrocopies | |
Sorex araneus | ENSSARG00000003732 | 2 retrocopies |