RetrogeneDB ID: | retro_ggor_1528 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 20:19098038..19098448(-) | ||
Located in intron of: | ENSGGOG00000000080 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | DUXA | ||
Ensembl ID: | ENSGGOG00000005650 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 70.63 % |
Parental protein coverage: | 69.12 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | MAEDTYSHKMVKTNHRRCRTKFTEEQLKILINTFNQKPYPGYATKQKLALEINTEE-SRIQIWFQNRRAR |
MAED..SHKMV.T.HR...TKFTE..LKILIN.FNQK.Y..YA.KQKLALEINTE..SRIQIWFQNRRAR | |
Retrocopy | MAEDNSSHKMVATSHRCSCTKFTED*LKILINSFNQKLYSDYAIKQKLALEINTEDPSRIQIWFQNRRAR |
Parental | HGFQKRPE-AETLESSQSQGQDQPGVEFQSREARRCRTTYSASQLHTLIKAFMKNPYPGIDSREELAKEI |
H.FQ.RP...ETLESSQS..QDQPG.E...R..R....T...SQL.TL.KAFMKNPYPGIDSRE..AK.I | |
Retrocopy | HRFQERPD<PETLESSQSHKQDQPGRE--ARRCRTTYST---SQLRTLNKAFMKNPYPGIDSREQIAK*I |
Parental | GVP |
G.P | |
Retrocopy | GAP |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .04 RPM | 0 .00 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .08 RPM | 0 .00 RPM |
SRP007412_liver | 0 .03 RPM | 0 .00 RPM |
SRP007412_testis | 0 .00 RPM | 0 .10 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2454 |
Pan troglodytes | retro_ptro_1418 |
Macaca mulatta | retro_mmul_636 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Dasypus novemcinctus | ENSDNOG00000025505 | 1 retrocopy | |
Felis catus | ENSFCAG00000007545 | 1 retrocopy | |
Homo sapiens | ENSG00000258873 | 5 retrocopies | |
Gorilla gorilla | ENSGGOG00000005650 | 7 retrocopies |
retro_ggor_1017, retro_ggor_1076, retro_ggor_1167, retro_ggor_1528 , retro_ggor_2133, retro_ggor_2752, retro_ggor_510,
|
Loxodonta africana | ENSLAFG00000030167 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000007788 | 5 retrocopies | |
Nomascus leucogenys | ENSNLEG00000010886 | 3 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000011331 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000010457 | 8 retrocopies | |
Pan troglodytes | ENSPTRG00000028871 | 5 retrocopies | |
Pteropus vampyrus | ENSPVAG00000003020 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000005321 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000014223 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000014200 | 2 retrocopies |