RetrogeneDB ID: | retro_mmul_636 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 10:51963564..51963908(-) | ||
| Located in intron of: | ENSMMUG00000012880 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | DUXA | ||
| Ensembl ID: | ENSMMUG00000007788 | ||
| Aliases: | None | ||
| Description: | double homeobox A [Source:HGNC Symbol;Acc:32179] |
| Percent Identity: | 71.54 % |
| Parental protein coverage: | 62.05 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | KFTEDQLKILINTFNQKPYPGYATKQKLALEINTEES-RIQIWFQNRRARQRFQKRPEA-DTLESSHSQG |
| KFTEDQLKILINTFNQK.Y..YA.K..LALEINTE...RIQIWFQN.RAR.RFQKRP....T.ESS..Q. | |
| Retrocopy | KFTEDQLKILINTFNQKLYSDYAIK--LALEINTEDPPRIQIWFQNQRARHRFQKRPDL<ETSESS--QS |
| Parental | QDQPGVEFQSREARRCRTTYSTSQLHTLIKAFVKNPYPGIDSREELAKEIGVP |
| Q.Q.......REARRC..TYSTSQL.TL.KAF.KN.YPGIDSRE.LAKEIG.P | |
| Retrocopy | QKQ---DQPGREARRCHNTYSTSQLCTLNKAFMKNSYPGIDSREQLAKEIGAP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .13 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .08 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2454 |
| Pan troglodytes | retro_ptro_1418 |
| Gorilla gorilla | retro_ggor_1528 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dasypus novemcinctus | ENSDNOG00000025505 | 1 retrocopy | |
| Felis catus | ENSFCAG00000007545 | 1 retrocopy | |
| Homo sapiens | ENSG00000258873 | 5 retrocopies | |
| Gorilla gorilla | ENSGGOG00000005650 | 7 retrocopies | |
| Loxodonta africana | ENSLAFG00000030167 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000007788 | 5 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000010886 | 3 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000011331 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000010457 | 8 retrocopies | |
| Pan troglodytes | ENSPTRG00000028871 | 5 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000003020 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000005321 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000014223 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000014200 | 2 retrocopies |