RetrogeneDB ID: | retro_tsyr_1577 | ||
Retrocopy location | Organism: | Tarsier (Tarsius syrichta) | |
| Coordinates: | scaffold_495641:330..520(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | DUXA | ||
| Ensembl ID: | ENSTSYG00000014223 | ||
| Aliases: | None | ||
| Description: | double homeobox A [Source:HGNC Symbol;Acc:32179] |
| Percent Identity: | 71.88 % |
| Parental protein coverage: | 54.39 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | LAKEIGVPESRVQTWFQNRRSRFHIQRKKAPDESLEQDQ-NKISEGVQGIEGAQNG-DLTNNSL |
| LAKEIG...SRVQ.WFQN.RSRF.IQRKK..DES.EQDQ..KISE.VQGIEG.Q.G..LT..SL | |
| Retrocopy | LAKEIGILDSRVQIWFQN*RSRFPIQRKKGTDESSEQDQ>DKISERVQGIEGTQTGTNLTDCSL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dasypus novemcinctus | ENSDNOG00000025505 | 1 retrocopy | |
| Felis catus | ENSFCAG00000007545 | 1 retrocopy | |
| Homo sapiens | ENSG00000258873 | 5 retrocopies | |
| Gorilla gorilla | ENSGGOG00000005650 | 7 retrocopies | |
| Loxodonta africana | ENSLAFG00000030167 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000007788 | 5 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000010886 | 3 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000011331 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000010457 | 8 retrocopies | |
| Pan troglodytes | ENSPTRG00000028871 | 5 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000003020 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000005321 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000014223 | 1 retrocopy |
retro_tsyr_1577 ,
|
| Tursiops truncatus | ENSTTRG00000014200 | 2 retrocopies |