RetrogeneDB ID: | retro_pabe_1805 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 20:13694489..13694899(-) | ||
Located in intron of: | ENSPPYG00000010740 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | DUXA | ||
Ensembl ID: | ENSPPYG00000010457 | ||
Aliases: | None | ||
Description: | double homeobox A [Source:HGNC Symbol;Acc:32179] |
Percent Identity: | 67.13 % |
Parental protein coverage: | 69.12 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | MAEDTYSHKRVTTNHRRCRTKFTEEQLKILIDTFNQKPYPGYATKQKLALEINTEE-SRIQIWFQNRRAR |
MAED..S.K.V.T.HRR..TKFTE..LKILI..FNQK.Y..YA.KQKLALEINTE...RIQIWFQNRRAR | |
Retrocopy | MAEDNSSYKMVATSHRRSCTKFTED*LKILINSFNQKLYSDYAIKQKLALEINTEDPPRIQIWFQNRRAR |
Parental | HGFQKRPE-AETLESSQSQGQGQPGVQFQSREARRCRTTYSASQLHTLIKAFMKNPYPGIDSREELAKEI |
H.FQ.RP...ETLESSQS..Q.QPG.....R..R....T...SQL.TL.KAFMKNPYPGIDSRE..AK.I | |
Retrocopy | HRFQERPD<PETLESSQSHKQDQPG--REARRCRTTYST---SQLCTLDKAFMKNPYPGIDSREQIAK*I |
Parental | GVP |
G.P | |
Retrocopy | GAP |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Dasypus novemcinctus | ENSDNOG00000025505 | 1 retrocopy | |
Felis catus | ENSFCAG00000007545 | 1 retrocopy | |
Homo sapiens | ENSG00000258873 | 5 retrocopies | |
Gorilla gorilla | ENSGGOG00000005650 | 7 retrocopies | |
Loxodonta africana | ENSLAFG00000030167 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000007788 | 5 retrocopies | |
Nomascus leucogenys | ENSNLEG00000010886 | 3 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000011331 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000010457 | 8 retrocopies |
retro_pabe_1192, retro_pabe_1328, retro_pabe_1805 , retro_pabe_3357, retro_pabe_3376, retro_pabe_518, retro_pabe_660, retro_pabe_802,
|
Pan troglodytes | ENSPTRG00000028871 | 5 retrocopies | |
Pteropus vampyrus | ENSPVAG00000003020 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000005321 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000014223 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000014200 | 2 retrocopies |