RetrogeneDB ID: | retro_ggor_225 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 1:26805995..26806223(+) | ||
Located in intron of: | ENSGGOG00000026648 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SNRPF | ||
Ensembl ID: | ENSGGOG00000001127 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 76.25 % |
Parental protein coverage: | 89.53 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 3 |
Parental | MSLPLNPKPFLNGLTGKPVMVK-LKWGMEYKGYLVS-VDGYMNMQLANT-EEYIDGALSGHLGEVLIRCN |
.SLPLNP..FL.GLTGKPVM.K..KWGMEYKGYL.S..DGYMNMQLAN..E.YI.G.LSGHLGEVLIR.. | |
Retrocopy | VSLPLNPEAFLSGLTGKPVMLK<TKWGMEYKGYLAS<LDGYMNMQLANK<EKYIGGELSGHLGEVLIRYK |
Parental | NVLYIRGVEE |
NVLY.RG.EE | |
Retrocopy | NVLYSRGMEE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .48 RPM | 5 .99 RPM |
SRP007412_cerebellum | 0 .47 RPM | 8 .08 RPM |
SRP007412_heart | 0 .00 RPM | 4 .16 RPM |
SRP007412_kidney | 0 .00 RPM | 15 .05 RPM |
SRP007412_liver | 0 .03 RPM | 11 .76 RPM |
SRP007412_testis | 0 .62 RPM | 14 .30 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_125 |
Pongo abelii | retro_pabe_489 |
Macaca mulatta | retro_mmul_361 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000002166 | 3 retrocopies | |
Bos taurus | ENSBTAG00000016271 | 1 retrocopy | |
Equus caballus | ENSECAG00000019817 | 1 retrocopy | |
Felis catus | ENSFCAG00000029966 | 4 retrocopies | |
Homo sapiens | ENSG00000139343 | 3 retrocopies | |
Gorilla gorilla | ENSGGOG00000001127 | 2 retrocopies |
retro_ggor_1549, retro_ggor_225 ,
|
Gorilla gorilla | ENSGGOG00000001310 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000009302 | 4 retrocopies | |
Mustela putorius furo | ENSMPUG00000007176 | 3 retrocopies | |
Mus musculus | ENSMUSG00000020018 | 4 retrocopies | |
Nomascus leucogenys | ENSNLEG00000005835 | 3 retrocopies | |
Pongo abelii | ENSPPYG00000004847 | 2 retrocopies | |
Pteropus vampyrus | ENSPVAG00000009036 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000005556 | 4 retrocopies | |
Sus scrofa | ENSSSCG00000000895 | 1 retrocopy |