RetrogeneDB ID: | retro_ggor_2375 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 6:119159422..119159703(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSGGOG00000000681 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 75.79 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | MVYISNGQVLDSR-SQSPWRLSLITDFFWGIAEFVVLFFKTLLQQDVKKRRSYGNSSDSRYDDGRGPPGN |
M.YI.NGQVLDSR.S.SPW.LSLITDFF..IA.FV.LFFKTLLQQ.VKKRR.YGN.SDSRYD.GR.PPGN | |
Retrocopy | MAYILNGQVLDSR<SPSPWSLSLITDFF*RIAKFVILFFKTLLQQHVKKRRGYGNTSDSRYDHGRQPPGN |
Parental | PPRRMGRINHLRGPSPPPMAGGUGR |
P....G.INHL..PSPPP.AGG.GR | |
Retrocopy | PLGKTGQINHLHVPSPPPKAGG*GR |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 15 .97 RPM |
SRP007412_cerebellum | 0 .00 RPM | 14 .62 RPM |
SRP007412_heart | 0 .00 RPM | 9 .41 RPM |
SRP007412_kidney | 0 .00 RPM | 16 .23 RPM |
SRP007412_liver | 0 .00 RPM | 13 .48 RPM |
SRP007412_testis | 0 .00 RPM | 37 .09 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_3513 |
Pan troglodytes | retro_ptro_2386 |
Pongo abelii | retro_pabe_2904 |
Macaca mulatta | retro_mmul_1861 |
Callithrix jacchus | retro_cjac_2374 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000007612 | 8 retrocopies | |
Cavia porcellus | ENSCPOG00000007172 | 4 retrocopies | |
Homo sapiens | ENSG00000113811 | 3 retrocopies | |
Gorilla gorilla | ENSGGOG00000000681 | 2 retrocopies |
retro_ggor_1481, retro_ggor_2375 ,
|
Microcebus murinus | ENSMICG00000017513 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000012622 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000019272 | 4 retrocopies | |
Mus musculus | ENSMUSG00000042682 | 9 retrocopies | |
Nomascus leucogenys | ENSNLEG00000026533 | 2 retrocopies | |
Ochotona princeps | ENSOPRG00000002266 | 6 retrocopies | |
Pongo abelii | ENSPPYG00000025894 | 3 retrocopies | |
Pan troglodytes | ENSPTRG00000015030 | 3 retrocopies | |
Pteropus vampyrus | ENSPVAG00000016291 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000014624 | 4 retrocopies | |
Sus scrofa | ENSSSCG00000011459 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000000506 | 2 retrocopies |