RetrogeneDB ID: | retro_opri_167 | ||
Retrocopy location | Organism: | Southern American pika (Ochotona princeps) | |
| Coordinates: | GeneScaffold_3173:436569..436794(-) | ||
| Located in intron of: | ENSOPRG00000006373 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSOPRG00000002266 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 50.63 % |
| Parental protein coverage: | 84.62 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | QSPWRLSLITDFFWGIAEFVVLFFKTLLQQDVKRR-RGYGSSSDSRYDDGRG-PPGNPPRRMGRINHLRG |
| QSP.RLS..T....G......LFFKTLLQQ.V..R.RG...S.D.RYDD.RG.P...P...M..INHL.G | |
| Retrocopy | QSPRRLSVVT-VSSGVQTSLWLFFKTLLQQNVQKR<RG*RNSCDFRYDDRRG>PENPP-QTMNGINHLQG |
| Parental | PSPPPMGGG |
| P...P...G | |
| Retrocopy | PHSLPLTSG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000007612 | 8 retrocopies | |
| Cavia porcellus | ENSCPOG00000007172 | 4 retrocopies | |
| Homo sapiens | ENSG00000113811 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000000681 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000017513 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000012622 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000019272 | 4 retrocopies | |
| Mus musculus | ENSMUSG00000042682 | 9 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000026533 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000002266 | 6 retrocopies | |
| Pongo abelii | ENSPPYG00000025894 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000015030 | 3 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000016291 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000014624 | 4 retrocopies | |
| Sus scrofa | ENSSSCG00000011459 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000000506 | 2 retrocopies |