RetrogeneDB ID: | retro_opri_745 | ||
Retrocopylocation | Organism: | Southern American pika (Ochotona princeps) | |
Coordinates: | scaffold_277:408982..409207(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSOPRG00000002266 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 50.63 % |
Parental protein coverage: | 84.62 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | QSPWRLSLITDFFWGIAEFVVLFFKTLLQQDVKRR-RGYGSSSDSRYDDGRG-PPGNPPRRMGRINHLRG |
QSP.RLS..T....G......LFFKTLLQQ.V..R.RG...S.D.RYDD.RG.P...P...M..INHL.G | |
Retrocopy | QSPRRLSVVT-VSSGVQTSLWLFFKTLLQQNVQKR<RG*RNSCDFRYDDRRG>PENPP-QTMNGINHLQG |
Parental | PSPPPMGGG |
P...P...G | |
Retrocopy | PHSLPLTSG |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000007612 | 8 retrocopies | |
Cavia porcellus | ENSCPOG00000007172 | 4 retrocopies | |
Homo sapiens | ENSG00000113811 | 3 retrocopies | |
Gorilla gorilla | ENSGGOG00000000681 | 2 retrocopies | |
Microcebus murinus | ENSMICG00000017513 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000012622 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000019272 | 4 retrocopies | |
Mus musculus | ENSMUSG00000042682 | 9 retrocopies | |
Nomascus leucogenys | ENSNLEG00000026533 | 2 retrocopies | |
Ochotona princeps | ENSOPRG00000002266 | 6 retrocopies | |
Pongo abelii | ENSPPYG00000025894 | 3 retrocopies | |
Pan troglodytes | ENSPTRG00000015030 | 3 retrocopies | |
Pteropus vampyrus | ENSPVAG00000016291 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000014624 | 4 retrocopies | |
Sus scrofa | ENSSSCG00000011459 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000000506 | 2 retrocopies |