RetrogeneDB ID: | retro_ggor_243 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 1:54244377..54244680(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ENSG00000234125 | ||
Ensembl ID: | ENSGGOG00000013557 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 57.14 % |
Parental protein coverage: | 51.22 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | SVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISG |
.V.LPYF.EH.DKD......SEY.FPE.LTQTF.SCNLI.GMFQ.L.KLRKNAFAS.ILFG.NN.SSISG | |
Retrocopy | NVVLPYFREHSDKDS----WSEYCFPEKLTQTFWSCNLIAGMFQQLNKLRKNAFASAILFGSNNISSISG |
Parental | VWVFRGQELAFPLSPDWQVDYESYTRKLDPGSEET |
.WVF.G......L.....V.....T.....G...T | |
Retrocopy | AWVFTGLDTESRLAGGLRVIHVAETGSWLQGDPDT |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 186 .35 RPM |
SRP007412_cerebellum | 0 .00 RPM | 209 .48 RPM |
SRP007412_heart | 0 .00 RPM | 245 .22 RPM |
SRP007412_kidney | 0 .00 RPM | 553 .39 RPM |
SRP007412_liver | 0 .00 RPM | 308 .31 RPM |
SRP007412_testis | 0 .00 RPM | 350 .06 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000015834 | 6 retrocopies | |
Erinaceus europaeus | ENSEEUG00000001231 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000013557 | 12 retrocopies | |
Latimeria chalumnae | ENSLACG00000014700 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000003339 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000006598 | 5 retrocopies | |
Monodelphis domestica | ENSMODG00000007691 | 1 retrocopy | |
Mus musculus | ENSMUSG00000071644 | 7 retrocopies | |
Rattus norvegicus | ENSRNOG00000020075 | 8 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000002851 | 2 retrocopies |