RetrogeneDB ID: | retro_ggor_243 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 1:54244377..54244680(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ENSG00000234125 | ||
| Ensembl ID: | ENSGGOG00000013557 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 57.14 % |
| Parental protein coverage: | 51.22 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | SVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISG |
| .V.LPYF.EH.DKD......SEY.FPE.LTQTF.SCNLI.GMFQ.L.KLRKNAFAS.ILFG.NN.SSISG | |
| Retrocopy | NVVLPYFREHSDKDS----WSEYCFPEKLTQTFWSCNLIAGMFQQLNKLRKNAFASAILFGSNNISSISG |
| Parental | VWVFRGQELAFPLSPDWQVDYESYTRKLDPGSEET |
| .WVF.G......L.....V.....T.....G...T | |
| Retrocopy | AWVFTGLDTESRLAGGLRVIHVAETGSWLQGDPDT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 186 .35 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 209 .48 RPM |
| SRP007412_heart | 0 .00 RPM | 245 .22 RPM |
| SRP007412_kidney | 0 .00 RPM | 553 .39 RPM |
| SRP007412_liver | 0 .00 RPM | 308 .31 RPM |
| SRP007412_testis | 0 .00 RPM | 350 .06 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000015834 | 6 retrocopies | |
| Erinaceus europaeus | ENSEEUG00000001231 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000013557 | 12 retrocopies | |
| Latimeria chalumnae | ENSLACG00000014700 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000003339 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000006598 | 5 retrocopies | |
| Monodelphis domestica | ENSMODG00000007691 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000071644 | 7 retrocopies | |
| Rattus norvegicus | ENSRNOG00000020075 | 8 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000002851 | 2 retrocopies |