RetrogeneDB ID: | retro_ggor_2502 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 7:10529902..10530195(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CDK2AP2 | ||
| Ensembl ID: | ENSGGOG00000010159 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 86.87 % |
| Parental protein coverage: | 77.78 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | SVPSPSGSVPGAGAPFRPLFNDFGPPSMGYVQAMKPP-GAQGSQSTYTDLLSVIEEMGKEIRPTYAGSKS |
| SV..PSGSV.GA.APFRPLFNDFGPPS.GYVQAMKPP.GAQGSQSTY.DLLSVIEE.GKEIRP.YAGSKS | |
| Retrocopy | SVSAPSGSVSGAVAPFRPLFNDFGPPSTGYVQAMKPP<GAQGSQSTYNDLLSVIEEKGKEIRPAYAGSKS |
| Parental | AMERLKRGIIHARALVRECLAETERNART |
| .MERLKR.IIHA.ALVRECLAETE.NART | |
| Retrocopy | TMERLKRVIIHAQALVRECLAETEWNART |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 12 .28 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 17 .45 RPM |
| SRP007412_heart | 0 .00 RPM | 18 .11 RPM |
| SRP007412_kidney | 0 .00 RPM | 16 .36 RPM |
| SRP007412_liver | 0 .00 RPM | 38 .33 RPM |
| SRP007412_testis | 0 .41 RPM | 4 .45 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3699 |
| Pan troglodytes | retro_ptro_2508 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000011370 | 1 retrocopy | |
| Equus caballus | ENSECAG00000020079 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000006428 | 3 retrocopies | |
| Homo sapiens | ENSG00000167797 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000009567 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000010159 | 3 retrocopies |
retro_ggor_2502 , retro_ggor_2799, retro_ggor_2800,
|
| Macaca mulatta | ENSMMUG00000011827 | 5 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000006438 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000008275 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000003966 | 9 retrocopies | |
| Tupaia belangeri | ENSTBEG00000005476 | 2 retrocopies |