RetrogeneDB ID: | retro_ptro_2508 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 7:9018889..9019182(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | CDK2AP2 | ||
Ensembl ID: | ENSPTRG00000003966 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 89.9 % |
Parental protein coverage: | 77.78 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | SVPSPSGSVPGAGAPFRPLFNDFGPPSMGYVQAMKPP-GAQGSQSTYTDLLSVIEEMGKEIRPTYAGSKS |
SV.SPSGSV.GA.APFRPLFNDFGPPSMGYVQAMKPP.GAQGSQSTY.DLLSVIEE.GKEI.P.YAGSKS | |
Retrocopy | SVSSPSGSVSGAVAPFRPLFNDFGPPSMGYVQAMKPP<GAQGSQSTYNDLLSVIEEKGKEIQPAYAGSKS |
Parental | AMERLKRGIIHARALVRECLAETERNART |
.MERLKRGIIHARALVRECLAETE.NART | |
Retrocopy | TMERLKRGIIHARALVRECLAETEWNART |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 22 .84 RPM |
SRP007412_cerebellum | 0 .00 RPM | 9 .57 RPM |
SRP007412_heart | 0 .00 RPM | 5 .65 RPM |
SRP007412_kidney | 0 .00 RPM | 31 .23 RPM |
SRP007412_liver | 0 .00 RPM | 45 .01 RPM |
SRP007412_testis | 0 .00 RPM | 1 .26 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_3699 |
Gorilla gorilla | retro_ggor_2502 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000011370 | 1 retrocopy | |
Equus caballus | ENSECAG00000020079 | 2 retrocopies | |
Echinops telfairi | ENSETEG00000006428 | 3 retrocopies | |
Homo sapiens | ENSG00000167797 | 4 retrocopies | |
Gorilla gorilla | ENSGGOG00000010159 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000011827 | 5 retrocopies | |
Nomascus leucogenys | ENSNLEG00000006438 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000008275 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000003966 | 9 retrocopies |
retro_ptro_2508 , retro_ptro_2973, retro_ptro_2976, retro_ptro_3002, retro_ptro_3003, retro_ptro_3004, retro_ptro_3005, retro_ptro_3008, retro_ptro_3009,
|
Pan troglodytes | ENSPTRG00000005596 | 3 retrocopies | |
Tupaia belangeri | ENSTBEG00000005476 | 2 retrocopies |