RetrogeneDB ID: | retro_ggor_2750 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 8:99298085..99298283(-) | ||
| Located in intron of: | ENSGGOG00000010949 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | UFM1 | ||
| Ensembl ID: | ENSGGOG00000026214 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 83.82 % |
| Parental protein coverage: | 64.08 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | RLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQT-AGNVFLKHGSELRIIPR-DRVGSC |
| ..SVPESTPFTAVL.FA.EEF.VPAA.SAIITNDGIG.NPAQT.AGNVFLKHGSELRIIPR..R.GSC | |
| Retrocopy | KYSVPESTPFTAVLQFATEEFQVPAARSAIITNDGIGKNPAQT>AGNVFLKHGSELRIIPR<SRDGSC |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 9 .40 RPM |
| SRP007412_cerebellum | 0 .04 RPM | 9 .30 RPM |
| SRP007412_heart | 0 .00 RPM | 1 .75 RPM |
| SRP007412_kidney | 0 .00 RPM | 22 .08 RPM |
| SRP007412_liver | 0 .03 RPM | 17 .33 RPM |
| SRP007412_testis | 0 .21 RPM | 13 .57 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_4098 |
| Pan troglodytes | retro_ptro_2779 |
| Pongo abelii | retro_pabe_3354 |
| Callithrix jacchus | retro_cjac_1489 |