RetrogeneDB ID: | retro_mmul_908 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 12:35159451..35159700(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MMU.4204 | ||
| Ensembl ID: | ENSMMUG00000014990 | ||
| Aliases: | None | ||
| Description: | ubiquitin-fold modifier 1 [Source:RefSeq peptide;Acc:NP_001244854] |
Retrocopy-Parental alignment summary:
>retro_mmul_908
ATGTAAAAGGTTTCCTTTAAGATCACTCTGACTTCCGACCTGCGGCTGCTGTACAAAGTACACAGTGTTTCTGAAAGTAC
ACCTTTCACAGCAGTCTTAAAGATTGCAGCAGAATAATTTAAAGTTTCTGCTGCAACAAGTGCAATTACTGCCAGTGATG
GAATATAAATAAATTCTGCACAGACTGCTGGAAATGTTTTTCTAAAACATGGTTCAGAACTACAAAGTATGCCTAGAGAT
TATATTGGA
ORF - retro_mmul_908 Open Reading Frame is not conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: | 78.31 % |
| Parental protein coverage: | 97.65 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 0 |
Retrocopy - Parental Gene Alignment:
| Parental | MSKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKH |
| M.KVSFKITLTSD.RL.YKV.SV.ESTPFTAVLK.AAE.FKV.AATSAI...DGI.IN.AQTAGNVFLKH | |
| Retrocopy | M*KVSFKITLTSDLRLLYKVHSVSESTPFTAVLKIAAE*FKVSAATSAITASDGI*INSAQTAGNVFLKH |
| Parental | GSELRIIPRDRVG |
| GSEL...PRD..G | |
| Retrocopy | GSELQSMPRDYIG |
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
(Hint: click retrocopy or parental gene accession number on the plot's legend, to show / hide expression level values)
Expression validation based on RNA-Seq data:
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 4 .15 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 4 .44 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 4 .46 RPM |
| SRP007412_heart | 0 .00 RPM | 2 .83 RPM |
| SRP007412_kidney | 0 .12 RPM | 10 .33 RPM |
| SRP007412_liver | 0 .00 RPM | 5 .30 RPM |
| SRP007412_testis | 0 .04 RPM | 2 .30 RPM |
Macaca mulatta was not studied using ChIP-Seq data.
No EST(s) were mapped for retro_mmul_908 retrocopy.
Macaca mulatta was not studied using FANTOM5 data.
retro_mmul_908 was not experimentally validated.
Retrocopy orthology:
Retrocopy retro_mmul_908 has 4 orthologous retrocopies within eutheria group .| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2177 |
| Pan troglodytes | retro_ptro_1660 |
| Pongo abelii | retro_pabe_2061 |
| Callithrix jacchus | retro_cjac_2807 |