RetrogeneDB ID: | retro_ggor_2928 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | X:72344085..72344400(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | BUD31 | ||
| Ensembl ID: | ENSGGOG00000015119 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 69.52 % |
| Parental protein coverage: | 72.92 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | GKRKVESLWPIFRIHHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQT |
| GK.KVESL.PIFRI.HQK...I.D..YK.K.I.R.LYEYCIKEGYA.KNLI...KKQ.YENLC.L...QT | |
| Retrocopy | GKWKVESLLPIFRIYHQKIYHIVDFVYKWKVITRALYEYCIKEGYAGKNLITIRKKQDYENLCWLLYLQT |
| Parental | RDTNFGTNCICRVPKSKLEVGRIIECTHCGCRGCS |
| ..TNFGTNC.C.VPK.K.EVG.IIEC.HC.C.GCS | |
| Retrocopy | WNTNFGTNCNCCVPKTKIEVGCIIECMHCSCQGCS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 14 .48 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 12 .29 RPM |
| SRP007412_heart | 0 .00 RPM | 3 .66 RPM |
| SRP007412_kidney | 0 .00 RPM | 18 .85 RPM |
| SRP007412_liver | 0 .00 RPM | 10 .16 RPM |
| SRP007412_testis | 0 .00 RPM | 41 .65 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_4712 |
| Pongo abelii | retro_pabe_3660 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000006269 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000020439 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000004055 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000000739 | 1 retrocopy | |
| Equus caballus | ENSECAG00000024151 | 2 retrocopies | |
| Ficedula albicollis | ENSFALG00000013804 | 1 retrocopy | |
| Homo sapiens | ENSG00000106245 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000015119 | 1 retrocopy |
retro_ggor_2928 ,
|
| Loxodonta africana | ENSLAFG00000012201 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000006920 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000017426 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000011020 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000017376 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000019451 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000007527 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000000989 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000010640 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000003005 | 1 retrocopy |