RetrogeneDB ID: | retro_nleu_2053 | ||
Retrocopy location | Organism: | Gibbon (Nomascus leucogenys) | |
| Coordinates: | GL397325.1:3996246..3996585(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | BUD31 | ||
| Ensembl ID: | ENSNLEG00000011020 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 64.6 % |
| Parental protein coverage: | 78.47 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 0 |
| Parental | RKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYIFDLFYKRKAISRELYEY |
| .K.P.D.W..IE.TLDEL.QK..EAE.E.HE.KR..E.LWP.FRI.H.K..YI...F...KAISREL..Y | |
| Retrocopy | QKMPCDNW*PIEATLDELNQKTKEAERELHEEKRPGECLWPTFRIPHWKSCYILEMFH*QKAISRELCAY |
| Parental | CIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICR |
| ..KE.YAD.NLIAKWK...Y..LCCLRC.QT.DTNFGTNCICR | |
| Retrocopy | *LKEDYADPNLIAKWKRDSYKALCCLRCVQTQDTNFGTNCICR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000006269 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000020439 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000004055 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000000739 | 1 retrocopy | |
| Equus caballus | ENSECAG00000024151 | 2 retrocopies | |
| Ficedula albicollis | ENSFALG00000013804 | 1 retrocopy | |
| Homo sapiens | ENSG00000106245 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000015119 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000012201 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000006920 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000017426 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000011020 | 1 retrocopy |
retro_nleu_2053 ,
|
| Pongo abelii | ENSPPYG00000017376 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000019451 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000007527 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000000989 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000010640 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000003005 | 1 retrocopy |