RetrogeneDB ID: | retro_pabe_3660 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | X:72658987..72659302(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | BUD31 | ||
Ensembl ID: | ENSPPYG00000017376 | ||
Aliases: | None | ||
Description: | BUD31 homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:29629] |
Percent Identity: | 74.29 % |
Parental protein coverage: | 72.92 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | GKRKVESLWPIFRIHHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQT |
GK.KVESL.PIFRI.HQK...I.D..YK.K.I.R.LYEYCIKEGYA.KNLI..WKKQGYENLC.L.C.QT | |
Retrocopy | GKWKVESLLPIFRIYHQKIHHIVDFVYKWKVITRALYEYCIKEGYAGKNLITIWKKQGYENLCWLLCLQT |
Parental | RDTNFGTNCICRVPKSKLEVGRIIECTHCGCRGCS |
R.TNFGTNC.C.VPK.K.EVG.IIEC.HCGC.GCS | |
Retrocopy | RNTNFGTNCNCSVPKTKIEVGCIIECMHCGCQGCS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 5 .69 RPM |
SRP007412_cerebellum | 0 .00 RPM | 6 .57 RPM |
SRP007412_heart | 0 .00 RPM | 2 .68 RPM |
SRP007412_kidney | 0 .00 RPM | 5 .20 RPM |
SRP007412_liver | 0 .00 RPM | 5 .66 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_4712 |
Gorilla gorilla | retro_ggor_2928 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000006269 | 2 retrocopies | |
Bos taurus | ENSBTAG00000020439 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000004055 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000000739 | 1 retrocopy | |
Equus caballus | ENSECAG00000024151 | 2 retrocopies | |
Ficedula albicollis | ENSFALG00000013804 | 1 retrocopy | |
Homo sapiens | ENSG00000106245 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000015119 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000012201 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000006920 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000017426 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000011020 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000017376 | 2 retrocopies |
retro_pabe_3313, retro_pabe_3660 ,
|
Pan troglodytes | ENSPTRG00000019451 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000007527 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000000989 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000010640 | 2 retrocopies | |
Tursiops truncatus | ENSTTRG00000003005 | 1 retrocopy |