RetrogeneDB ID: | retro_ggor_732 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 11:82267972..82268274(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RHOC | ||
Ensembl ID: | ENSGGOG00000002741 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 59.8 % |
Parental protein coverage: | 52.33 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | ENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPD-SLENIPEKWTPEVKHFCP |
EN.I.DIEV.GK...LA.WDT.GQE..D.LR.LSYPDT.VIL.C....S...SLEN.P...T.E.K.FCP | |
Retrocopy | ENNIDDIEVKGKYMGLAIWDTVGQEGQDHLRTLSYPDTSVILRCSFVNSFG<SLENLPGQRTLESKRFCP |
Parental | NVPIILVGNKKDLRQDEHTRRELAKMKQEPVR |
NV..ILVGNK..L..D.H.R..L.KMKQE.V. | |
Retrocopy | NVYSILVGNKMHLLKDGHIRQDLTKMKQELVK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .05 RPM | 44 .02 RPM |
SRP007412_cerebellum | 0 .08 RPM | 36 .80 RPM |
SRP007412_heart | 0 .00 RPM | 115 .76 RPM |
SRP007412_kidney | 0 .00 RPM | 176 .35 RPM |
SRP007412_liver | 0 .00 RPM | 65 .81 RPM |
SRP007412_testis | 0 .00 RPM | 55 .43 RPM |
Species | RetrogeneDB ID |
---|---|
Pan troglodytes | retro_ptro_625 |
Equus caballus | retro_ecab_932 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000014299 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000013413 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000013657 | 2 retrocopies | |
Equus caballus | ENSECAG00000010174 | 3 retrocopies | |
Ficedula albicollis | ENSFALG00000000736 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000002741 | 2 retrocopies |
retro_ggor_18, retro_ggor_732 ,
|
Gorilla gorilla | ENSGGOG00000012843 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000004807 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000000981 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000027678 | 3 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000001981 | 1 retrocopy | |
Taeniopygia guttata | ENSTGUG00000017533 | 1 retrocopy | |
Tetraodon nigroviridis | ENSTNIG00000015041 | 1 retrocopy | |
Xenopus tropicalis | ENSXETG00000006898 | 1 retrocopy | |
Xiphophorus maculatus | ENSXMAG00000008103 | 1 retrocopy |