RetrogeneDB ID: | retro_cjac_2027 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 21:27282259..27282648(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RHOC | ||
| Ensembl ID: | ENSCJAG00000013657 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 83.33 % |
| Parental protein coverage: | 67.88 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | QEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELA |
| QE.YD.L.PLS.PDTD.ILMCFSI.S.DSLENIPEKWTPEVK.FCPNVP.ILVGNK.D.RQD.HTRRELA | |
| Retrocopy | QEGYDQLWPLSHPDTDAILMCFSIHSLDSLENIPEKWTPEVKPFCPNVPVILVGNK-DVRQDDHTRRELA |
| Parental | KMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKR-RRGCPIL |
| K.KQEPV.SEEGRD.ANRISAFG.LECSAKTKEGVREVFE.AT.AGLQV.KNK..R.GCPIL | |
| Retrocopy | KTKQEPVQSEEGRDTANRISAFG*LECSAKTKEGVREVFETATGAGLQVCKNKH<REGCPIL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 17 .62 RPM |
| SRP051959_heart | 0 .00 RPM | 16 .72 RPM |
| SRP051959_kidney | 0 .00 RPM | 21 .08 RPM |
| SRP051959_liver | 0 .00 RPM | 20 .51 RPM |
| SRP051959_lung | 0 .00 RPM | 17 .57 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 6 .16 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 15 .26 RPM |
| SRP051959_spleen | 0 .00 RPM | 12 .63 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000014299 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000013413 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000003904 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000013018 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000013657 | 2 retrocopies |
retro_cjac_1657, retro_cjac_2027 ,
|
| Equus caballus | ENSECAG00000010174 | 3 retrocopies | |
| Ficedula albicollis | ENSFALG00000000736 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000002741 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000004807 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000000981 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000027678 | 3 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000001981 | 1 retrocopy | |
| Taeniopygia guttata | ENSTGUG00000017533 | 1 retrocopy | |
| Tetraodon nigroviridis | ENSTNIG00000015041 | 1 retrocopy | |
| Xenopus tropicalis | ENSXETG00000006898 | 1 retrocopy | |
| Xiphophorus maculatus | ENSXMAG00000008103 | 1 retrocopy |