RetrogeneDB ID: | retro_ggor_880 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 12:62755325..62755650(-) | ||
| Located in intron of: | ENSGGOG00000006089 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MRPS25 | ||
| Ensembl ID: | ENSGGOG00000011005 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 63.16 % |
| Parental protein coverage: | 64.74 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 2 |
| Parental | PWVQIMMFKNMTPSPFLRFYLDSGEQVLVDVETKSNKEIMEHIRKILGKNEETLRE-EEEEKKQLSHPAN |
| PW.QIMMFKN..P.PFL.FYL...E.VLVD.E.K.NKEIMEHI.KI.GKNE.T..E.E.E.KKQLSH.A. | |
| Retrocopy | PWMQIMMFKNTIPLPFLQFYLYYEEHVLVDIEIKMNKEIMEHIKKIVGKNEDTRKE<EQE-KKQLSHRAH |
| Parental | FG-PRKYCLRECICEVEGQVPCPSLVPLPKEMRGKYKAALKADA |
| FG.P.K....E..CEV.GQVP.P.L.....E..GKYKA.LKA.A | |
| Retrocopy | FG<PSK*F*WESTCEVKGQVPYPGL--MH*EKTGKYKATLKASA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .05 RPM | 28 .24 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 19 .86 RPM |
| SRP007412_heart | 0 .03 RPM | 19 .11 RPM |
| SRP007412_kidney | 0 .04 RPM | 52 .38 RPM |
| SRP007412_liver | 0 .16 RPM | 28 .41 RPM |
| SRP007412_testis | 0 .21 RPM | 44 .65 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1127 |
| Pan troglodytes | retro_ptro_678 |
| Pongo abelii | retro_pabe_932 |
| Macaca mulatta | retro_mmul_874 |
| Callithrix jacchus | retro_cjac_3303 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000017160 | 1 retrocopy | |
| Homo sapiens | ENSG00000131368 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000011005 | 1 retrocopy |
retro_ggor_880 ,
|
| Latimeria chalumnae | ENSLACG00000009006 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000005157 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000005218 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000013409 | 1 retrocopy | |
| Pelodiscus sinensis | ENSPSIG00000008882 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000014658 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000010912 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000027997 | 1 retrocopy |