RetrogeneDB ID: | retro_itri_1065 | ||
Retrocopy location | Organism: | Squirrel (Ictidomys tridecemlineatus) | |
| Coordinates: | JH393366.1:1573521..1573836(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | COPS8 | ||
| Ensembl ID: | ENSSTOG00000022662 | ||
| Aliases: | None | ||
| Description: | COP9 signalosome subunit 8 [Source:HGNC Symbol;Acc:24335] |
| Percent Identity: | 79.05 % |
| Parental protein coverage: | 50.24 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MAEGAFSFKKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSELGGIW |
| .AEGAFSFKKLL..CENQELEAPG.IA.PP.Y.QLL.L.LLHND.NN.R.LW.RIPP.IKSANSELG.IW | |
| Retrocopy | VAEGAFSFKKLLI*CENQELEAPGRIAIPPGYHQLLVLCLLHNDVNNERHLWERIPPDIKSANSELGRIW |
| Parental | SVGQRIWQRDFPGIYMTISAHQWSETVQPIMDALR |
| SV.Q.IWQRDFPGIY.TIS.HQWS.TV.PIMDA.R | |
| Retrocopy | SVEQKIWQRDFPGIYVTISTHQWSQTVKPIMDAQR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000005854 | 3 retrocopies | |
| Canis familiaris | ENSCAFG00000030168 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000002267 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000015309 | 5 retrocopies | |
| Homo sapiens | ENSG00000198612 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000008189 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000021605 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000007474 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000000068 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000034432 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000010706 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000007341 | 4 retrocopies | |
| Pongo abelii | ENSPPYG00000013308 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000019635 | 3 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000022662 | 4 retrocopies | |
| Tupaia belangeri | ENSTBEG00000015944 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000002196 | 7 retrocopies | |
| Tursiops truncatus | ENSTTRG00000013614 | 1 retrocopy |