RetrogeneDB ID: | retro_itri_415 | ||
Retrocopy location | Organism: | Squirrel (Ictidomys tridecemlineatus) | |
| Coordinates: | JH393290.1:7078130..7078373(+) | ||
| Located in intron of: | ENSSTOG00000027393 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | LSM5 | ||
| Ensembl ID: | ENSSTOG00000012662 | ||
| Aliases: | None | ||
| Description: | LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae) [Source:HGNC Symbol;Acc:17162] |
| Percent Identity: | 82.72 % |
| Parental protein coverage: | 89.01 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | QLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNIT |
| ...PLELVDK.IGS.I.IVMKSD.EIVGTLL.FDDFVNMVL.DVTEF.ITPEGRRITKLDQILL.G.NIT | |
| Retrocopy | KMQPLELVDKYIGSKIYIVMKSDNEIVGTLLEFDDFVNMVLADVTEFAITPEGRRITKLDQILLYGYNIT |
| Parental | MLVPGGEGPEV |
| MLVP.G.GPEV | |
| Retrocopy | MLVPDGKGPEV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000005335 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000009185 | 3 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000008121 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000018068 | 8 retrocopies | |
| Pongo abelii | ENSPPYG00000017661 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000042126 | 3 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000012662 | 4 retrocopies | |
| Tarsius syrichta | ENSTSYG00000006449 | 9 retrocopies |