RetrogeneDB ID: | retro_pabe_3449 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 9:120621411..120621607(+) | ||
Located in intron of: | ENSPPYG00000019592 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | LSM5 | ||
Ensembl ID: | ENSPPYG00000017661 | ||
Aliases: | None | ||
Description: | U6 snRNA-associated Sm-like protein LSm5 [Source:RefSeq peptide;Acc:NP_001126628] |
Percent Identity: | 75. % |
Parental protein coverage: | 72.53 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | MAANATTNP-SQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVN-ILLKDVTEFEITPEGRRI |
MAA.ATT....QLL.LELVDKCIGSRI.IV.KS..EIVGTLLG.DDFVN...L..VTEFEITPEGR.I | |
Retrocopy | MAAKATTYL<AQLLLLELVDKCIGSRIRIVVKSN*EIVGTLLGVDDFVN<YGLEEVTEFEITPEGRSI |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 3 .15 RPM |
SRP007412_cerebellum | 0 .00 RPM | 7 .54 RPM |
SRP007412_heart | 0 .00 RPM | 3 .94 RPM |
SRP007412_kidney | 0 .00 RPM | 5 .73 RPM |
SRP007412_liver | 0 .00 RPM | 3 .37 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_4216 |
Pan troglodytes | retro_ptro_2862 |
Gorilla gorilla | retro_ggor_2824 |