RetrogeneDB ID: | retro_cjac_3068 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 8:43695979..43696154(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSCJAG00000009185 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 51.61 % |
Parental protein coverage: | 65.93 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 2 |
Parental | SDKEIVGTLLGFDDFVNMVLED-VTEFEITPEGRRIT-KLDQILLNGNNITMLVPGGEGPEV |
SDKEIV.TLL...D..N..L.D...EF....E.R.IT..L..I....N..TMLVPG..GPEV | |
Retrocopy | SDKEIVITLLRLNDVINILLDD<FNEFKVSLE-RLIT<QLKYIW*RRNSTTMLVPGK*GPEV |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .00 RPM | 3 .62 RPM |
SRP051959_heart | 0 .00 RPM | 3 .91 RPM |
SRP051959_kidney | 0 .00 RPM | 5 .70 RPM |
SRP051959_liver | 0 .00 RPM | 6 .45 RPM |
SRP051959_lung | 0 .00 RPM | 3 .94 RPM |
SRP051959_lymph_node | 0 .00 RPM | 5 .11 RPM |
SRP051959_skeletal_muscle | 0 .00 RPM | 4 .19 RPM |
SRP051959_spleen | 0 .00 RPM | 5 .90 RPM |