RetrogeneDB ID: | retro_lafr_550 | ||
Retrocopylocation | Organism: | Elephant (Loxodonta africana) | |
Coordinates: | scaffold_21:295296..295633(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RBPMS2 | ||
Ensembl ID: | ENSLAFG00000018725 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 50.85 % |
Parental protein coverage: | 63.33 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 4 |
Parental | IKLTSRQPVGFVIFDS-RAGAEAAKNALNGIRFDPENPQTLRLEF-AKANTKMAKSKLMATPNPTSA-HP |
IK...RQPVGFV.FDS..A..E.AK....GI.F...N..TL.LEF..KAN.KM....LM.T.N.T...HP | |
Retrocopy | IKFILRQPVGFVTFDS>EAEVEVAKYIFSGICFHSSNQ*TLSLEF<SKANIKMTTNRLMVTSNSTKS<HP |
Parental | ALGAHFIARDPYDLMGAALIPASPEAW-APYPLYTTELTPAISHAAFT |
.LGAHFI..D..DL.G.ALI....E.W...Y..Y.T.L...I.H..FT | |
Retrocopy | KLGAHFI-EDSHDLVGEALIFMCLEVW<VLYMVYPTKLILNITHDGFT |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000011037 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000005200 | 2 retrocopies | |
Dipodomys ordii | ENSDORG00000004025 | 1 retrocopy | |
Homo sapiens | ENSG00000166831 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000008984 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000018725 | 6 retrocopies | |
Macaca mulatta | ENSMMUG00000013270 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000010487 | 1 retrocopy | |
Mus musculus | ENSMUSG00000032387 | 9 retrocopies | |
Nomascus leucogenys | ENSNLEG00000012505 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000026017 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000006553 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000007165 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000004549 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000010055 | 2 retrocopies | |
Tarsius syrichta | ENSTSYG00000008996 | 3 retrocopies | |
Tursiops truncatus | ENSTTRG00000011840 | 3 retrocopies |