RetrogeneDB ID: | retro_ptro_1458 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 21:2196958..2197270(-) | ||
Located in intron of: | ENSPTRG00000013793 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RBPMS2 | ||
Ensembl ID: | ENSPTRG00000007165 | ||
Aliases: | None | ||
Description: | RNA binding protein with multiple splicing 2 [Source:HGNC Symbol;Acc:19098] |
Percent Identity: | 51.33 % |
Parental protein coverage: | 51.2 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 3 |
Parental | LEFAKANTKMAKSKLMATP-NPSNVHPALGAHFIARD-PYDLM-GAALIPASPEAWAPYPLYTTE---LT |
L.FA.ANTK..K.K.MA.P.....VH.ALG.H..A.D.P.DL..GAALI...P.A..PYPLYTTE...LT | |
Retrocopy | LRFA*ANTKTDKNKVMANP<HIGGVHTALGPHLLAQD<PHDLR<GAALISVTPKA*NPYPLYTTETTELT |
Parental | PAISHAAFTYPAATAAAAALHAQVRWYPSSDTTQQGWKYRQFC |
..I..AAF.Y..AT...A..H....W......TQQ.WK..QFC | |
Retrocopy | RVILYAAFSY-SATVRHAQVH----WCSPPGATQQEWKHCQFC |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .04 RPM | 4 .29 RPM |
SRP007412_cerebellum | 0 .00 RPM | 1 .11 RPM |
SRP007412_heart | 0 .03 RPM | 77 .56 RPM |
SRP007412_kidney | 0 .05 RPM | 12 .11 RPM |
SRP007412_liver | 0 .00 RPM | 4 .65 RPM |
SRP007412_testis | 0 .00 RPM | 5 .59 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2513 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000011037 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000005200 | 2 retrocopies | |
Dipodomys ordii | ENSDORG00000004025 | 1 retrocopy | |
Homo sapiens | ENSG00000166831 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000008984 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000018725 | 6 retrocopies | |
Macaca mulatta | ENSMMUG00000013270 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000010487 | 1 retrocopy | |
Mus musculus | ENSMUSG00000032387 | 9 retrocopies | |
Nomascus leucogenys | ENSNLEG00000012505 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000026017 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000006553 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000007165 | 2 retrocopies |
retro_ptro_1458 , retro_ptro_2441,
|
Sus scrofa | ENSSSCG00000004549 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000010055 | 2 retrocopies | |
Tarsius syrichta | ENSTSYG00000008996 | 3 retrocopies | |
Tursiops truncatus | ENSTTRG00000011840 | 3 retrocopies |