RetrogeneDB ID: | retro_lcha_65 | ||
Retrocopylocation | Organism: | Coelacanth (Latimeria chalumnae) | |
Coordinates: | JH127152.1:321561..321772(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | eif1axb | ||
Ensembl ID: | ENSLACG00000015565 | ||
Aliases: | None | ||
Description: | eukaryotic translation initiation factor 1A, X-linked, b [Source:ZFIN;Acc:ZDB-GENE-030131-1319] |
Percent Identity: | 67.61 % |
Parental protein coverage: | 85.37 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | QVWINTSDIILIGLRDYQDTKADVILKYNADEARSLKAYGELPEHAKI-NETDTFGPGDDDEIQFDDIGD |
.VW.NTSD..L.GLRD.QD.....I.KYN.DEARSLKAYGEL....KI.N.TDTFGPG.DDE..FDD.GD | |
Retrocopy | KVWTNTSDMRLVGLRDNQDI*TELIRKYNVDEARSLKAYGELHNMPKI>NQTDTFGPGYDDET*FDDTGD |
Parental | D |
D | |
Retrocopy | D |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
DRP000627_gill | 0 .06 RPM | 70 .75 RPM |
DRP000627_kidney | 0 .08 RPM | 68 .04 RPM |
DRP000627_pectoral_fin | 0 .04 RPM | 60 .01 RPM |
DRP000627_pelvic_fin | 0 .00 RPM | 82 .04 RPM |
DRP000627_pharynx | 0 .18 RPM | 88 .32 RPM |
DRP000627_tail_muscle | 0 .30 RPM | 56 .67 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000016604 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000005371 | 1 retrocopy | |
Homo sapiens | ENSG00000173674 | 2 retrocopies | |
Latimeria chalumnae | ENSLACG00000015565 | 1 retrocopy |
retro_lcha_65 ,
|
Microcebus murinus | ENSMICG00000004110 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000012977 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000000193 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000027820 | 1 retrocopy | |
Mus musculus | ENSMUSG00000067194 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000009913 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000008182 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000022504 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000005736 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000029864 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000017492 | 6 retrocopies |