RetrogeneDB ID: | retro_lcha_95 | ||
Retrocopylocation | Organism: | Coelacanth (Latimeria chalumnae) | |
Coordinates: | JH127916.1:441765..442035(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | NDUFS6 | ||
Ensembl ID: | ENSLACG00000004625 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 68.89 % |
Parental protein coverage: | 70.31 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | MAASCLRLTPFFHIQGGRAVWTICKVSAKNYRHQNVATGEKVTHTGQVYDNKDYRRVRFVGRQKEVNESF |
MAA..L.L.PF.HI.GG..VW.ICKVSA.N..HQ....G.KVTHTGQ..DNKDYR..RFVG.QKEVNESF | |
Retrocopy | MAAASLWLAPFLHIKGGWVVWIICKVSAQNCGHQSTSAGKKVTHTGQDHDNKDYR*IRFVGCQKEVNESF |
Parental | AIDLVAEEPVTEVEDRVTSC |
AID..AEEPV.EV..RV.SC | |
Retrocopy | AIDILAEEPVIEVKGRVSSC |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
DRP000627_gill | 0 .00 RPM | 19 .59 RPM |
DRP000627_kidney | 0 .00 RPM | 25 .23 RPM |
DRP000627_pectoral_fin | 0 .00 RPM | 26 .74 RPM |
DRP000627_pelvic_fin | 0 .00 RPM | 29 .01 RPM |
DRP000627_pharynx | 0 .00 RPM | 23 .02 RPM |
DRP000627_tail_muscle | 0 .00 RPM | 17 .31 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000010930 | 2 retrocopies | |
Bos taurus | ENSBTAG00000009914 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000019382 | 1 retrocopy | |
Equus caballus | ENSECAG00000021690 | 3 retrocopies | |
Homo sapiens | ENSG00000145494 | 1 retrocopy | |
Latimeria chalumnae | ENSLACG00000004625 | 1 retrocopy |
retro_lcha_95 ,
|
Loxodonta africana | ENSLAFG00000005708 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000016888 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000004447 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000001425 | 1 retrocopy | |
Mus musculus | ENSMUSG00000021606 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000011199 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000004581 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000015323 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000016706 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000023387 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000049394 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000017779 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000003715 | 1 retrocopy |