RetrogeneDB ID: | retro_lcha_95 | ||
Retrocopy location | Organism: | Coelacanth (Latimeria chalumnae) | |
| Coordinates: | JH127916.1:441765..442035(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NDUFS6 | ||
| Ensembl ID: | ENSLACG00000004625 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 68.89 % |
| Parental protein coverage: | 70.31 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MAASCLRLTPFFHIQGGRAVWTICKVSAKNYRHQNVATGEKVTHTGQVYDNKDYRRVRFVGRQKEVNESF |
| MAA..L.L.PF.HI.GG..VW.ICKVSA.N..HQ....G.KVTHTGQ..DNKDYR..RFVG.QKEVNESF | |
| Retrocopy | MAAASLWLAPFLHIKGGWVVWIICKVSAQNCGHQSTSAGKKVTHTGQDHDNKDYR*IRFVGCQKEVNESF |
| Parental | AIDLVAEEPVTEVEDRVTSC |
| AID..AEEPV.EV..RV.SC | |
| Retrocopy | AIDILAEEPVIEVKGRVSSC |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| DRP000627_gill | 0 .00 RPM | 19 .59 RPM |
| DRP000627_kidney | 0 .00 RPM | 25 .23 RPM |
| DRP000627_pectoral_fin | 0 .00 RPM | 26 .74 RPM |
| DRP000627_pelvic_fin | 0 .00 RPM | 29 .01 RPM |
| DRP000627_pharynx | 0 .00 RPM | 23 .02 RPM |
| DRP000627_tail_muscle | 0 .00 RPM | 17 .31 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000010930 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000009914 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000019382 | 1 retrocopy | |
| Equus caballus | ENSECAG00000021690 | 3 retrocopies | |
| Homo sapiens | ENSG00000145494 | 1 retrocopy | |
| Latimeria chalumnae | ENSLACG00000004625 | 1 retrocopy |
retro_lcha_95 ,
|
| Loxodonta africana | ENSLAFG00000005708 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000016888 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000004447 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000001425 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000021606 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000011199 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000004581 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000015323 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000016706 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000023387 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000049394 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000017779 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000003715 | 1 retrocopy |