RetrogeneDB ID: | retro_pabe_2350 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 3:138408792..138409153(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | NDUFS6 | ||
Ensembl ID: | ENSPPYG00000015323 | ||
Aliases: | None | ||
Description: | NADH dehydrogenase (ubiquinone) Fe-S protein 6, 13kDa (NADH-coenzyme Q reductase) [Source:HGNC Symbol;Acc:7713] |
Percent Identity: | 64.52 % |
Parental protein coverage: | 99.19 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | MAAAMTFYRLLNRWGEAARSLHLGARCFGVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQKEVNENFAID |
MAAAM..Y.LL......A..L..GARCFGV...PTGEKV.H..QV.D.KD.R.I.FVG.QKEVN.NFA.D | |
Retrocopy | MAAAM-IYQLLGWSSIVALNLPSGARCFGV*ALPTGEKVLHASQV-DNKDSRKIQFVGCQKEVNINFATD |
Parental | LIAEQPVSEVETRVIACD-GGGGALGHPKVYINLDKETKTGTCGYCGLQFRQHH |
LI.EQP.SEVE..VI.C..G.G.ALG.PKV..N.DKETKTG.CGYCGL.F..HH | |
Retrocopy | LITEQPMSEVESWVILCN>GWG-ALGYPKVCVNIDKETKTGICGYCGL*FKKHH |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 30 .47 RPM |
SRP007412_cerebellum | 0 .00 RPM | 14 .23 RPM |
SRP007412_heart | 0 .00 RPM | 59 .57 RPM |
SRP007412_kidney | 0 .00 RPM | 51 .34 RPM |
SRP007412_liver | 0 .00 RPM | 23 .87 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2838 |
Pan troglodytes | retro_ptro_1924 |
Macaca mulatta | retro_mmul_1473 |
Callithrix jacchus | retro_cjac_1552 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000010930 | 2 retrocopies | |
Bos taurus | ENSBTAG00000009914 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000019382 | 1 retrocopy | |
Equus caballus | ENSECAG00000021690 | 3 retrocopies | |
Homo sapiens | ENSG00000145494 | 1 retrocopy | |
Latimeria chalumnae | ENSLACG00000004625 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000005708 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000016888 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000004447 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000001425 | 1 retrocopy | |
Mus musculus | ENSMUSG00000021606 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000011199 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000004581 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000015323 | 1 retrocopy |
retro_pabe_2350 ,
|
Pan troglodytes | ENSPTRG00000016706 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000023387 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000049394 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000017779 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000003715 | 1 retrocopy |