RetrogeneDB ID: | retro_mdom_1249 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
Coordinates: | 4:99782704..99783019(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | C11orf58 | ||
Ensembl ID: | ENSMODG00000007147 | ||
Aliases: | None | ||
Description: | chromosome 11 open reading frame 58 [Source:HGNC Symbol;Acc:16990] |
Percent Identity: | 89.52 % |
Parental protein coverage: | 56.76 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | MSAARESHPHGVKRSASPDDDIGSSNWEAADLGNEERKQKFLRLMGAGKKEHTGRLVIGDHRSTSHFRTG |
MS.A.ESHPHGVK.SASPD.DIGSSNWEAA.LGNEERKQKFLRLMGAGKKEHT.R.VIGDHRSTSHFRT. | |
Retrocopy | MSVA*ESHPHGVKCSASPDNDIGSSNWEAANLGNEERKQKFLRLMGAGKKEHTYRFVIGDHRSTSHFRTR |
Parental | EEDKKMNEELESQYQQSMDSKLSGRYRRHCGLGFS |
EEDK.MNE.LESQ.QQSMDSKLSGRYRRHCGLGFS | |
Retrocopy | EEDKQMNEDLESQNQQSMDSKLSGRYRRHCGLGFS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000030220 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000009626 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000009679 | 2 retrocopies | |
Equus caballus | ENSECAG00000011778 | 1 retrocopy | |
Felis catus | ENSFCAG00000027747 | 1 retrocopy | |
Homo sapiens | ENSG00000110696 | 2 retrocopies | |
Macropus eugenii | ENSMEUG00000011795 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000001589 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000007147 | 2 retrocopies |
retro_mdom_1249 , retro_mdom_672,
|
Mus musculus | ENSMUSG00000030663 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000017719 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000025335 | 2 retrocopies | |
Ochotona princeps | ENSOPRG00000000154 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000003458 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000020436 | 1 retrocopy |