RetrogeneDB ID: | retro_mmus_2190 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 3:95144507..95144906(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSMUSG00000098198 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | 1110004F10Rik | ||
| Ensembl ID: | ENSMUSG00000030663 | ||
| Aliases: | 1110004F10Rik, Smacp, Smap, sid2057, sid2057p | ||
| Description: | RIKEN cDNA 1110004F10 gene [Source:MGI Symbol;Acc:MGI:1929274] |
| Percent Identity: | 71.43 % |
| Parental protein coverage: | 96.35 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | KEHTGRLVIGDHKSTSHFRTGEEDKKINEELES-QYQQSMDSKLSGRYRRHCGLGFSEVEDHDGEGDVAG |
| .E....LV......T....T.E..KK......S.....S..S....RYRRHCGLGFSEVEDH.GE.DVA. | |
| Retrocopy | QERKNTLVVLL*EITNQHLTSEQGKKTRKLMKSWSLSTSRASTAN*RYRRHCGLGFSEVEDHYGEDDVAR |
| Parental | DDDEDDSPDAESPDDSDSDSESEKEESAEELHAAEHPDDTEDPKSKKDAKSNYKMMFVKSSGS |
| DDDEDDSPDAESPDDSDSDSESEKEESAEELHAAEHPDDTEDPKSKKDAKSNYKMMFVKSSGS | |
| Retrocopy | DDDEDDSPDAESPDDSDSDSESEKEESAEELHAAEHPDDTEDPKSKKDAKSNYKMMFVKSSGS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .09 RPM | 49 .51 RPM |
| SRP007412_cerebellum | 0 .17 RPM | 52 .11 RPM |
| SRP007412_heart | 0 .00 RPM | 33 .03 RPM |
| SRP007412_kidney | 0 .02 RPM | 39 .06 RPM |
| SRP007412_liver | 0 .00 RPM | 27 .50 RPM |
| SRP007412_testis | 0 .14 RPM | 45 .69 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000030220 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000009626 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000009679 | 2 retrocopies | |
| Equus caballus | ENSECAG00000011778 | 1 retrocopy | |
| Felis catus | ENSFCAG00000027747 | 1 retrocopy | |
| Homo sapiens | ENSG00000110696 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000011795 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000001589 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000007147 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000030663 | 2 retrocopies |
retro_mmus_2190 , retro_mmus_2616,
|
| Nomascus leucogenys | ENSNLEG00000017719 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000025335 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000000154 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000003458 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000020436 | 1 retrocopy |