RetrogeneDB ID: | retro_mdom_331 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
Coordinates: | 1:164789539..164789962(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSMODG00000001899 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 78.72 % |
Parental protein coverage: | 64.68 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 0 |
Parental | ILRYIARQYNLCGETEEERIRVDMLENHVMDIRMQLARVCYNPNFEVMKIEYLQQLPGQLKLFSLFLGKC |
IL.YIA..YNLC.E.EEE.I.VD.LENH.MDI.MQL..VCYNPNFE..KIE.L.QLPGQLKLFSLFLGKC | |
Retrocopy | ILHYIAQKYNLCSEMEEEHIQVDVLENHIMDIQMQLVHVCYNPNFEIIKIECLHQLPGQLKLFSLFLGKC |
Parental | SWFAGNKITFVDFLVYDVLDQNRKFEPSCLEKFSNLKEFLHRFESLSSIATYLASERCQPYPIFAKMACW |
.WFAGNKIT.VDFLV.DVLDQN.KFEP.CL.KF..LKEFLH.FESLSSI.TYLA.E.CQ.YPIF.KMACW | |
Retrocopy | TWFAGNKITYVDFLV*DVLDQN*KFEPTCL*KFLKLKEFLHWFESLSSISTYLAFEHCQLYPIFTKMACW |
Parental | G |
G | |
Retrocopy | G |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .33 RPM | 0 .00 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000005380 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000003168 | 1 retrocopy | |
Erinaceus europaeus | ENSEEUG00000014211 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000005817 | 2 retrocopies | |
Homo sapiens | ENSG00000134202 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000005185 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000008029 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000001899 | 1 retrocopy |
retro_mdom_331 ,
|
Mus musculus | ENSMUSG00000004032 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000003302 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000001063 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000047034 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000006821 | 2 retrocopies | |
Tarsius syrichta | ENSTSYG00000006736 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000009682 | 1 retrocopy |