RetrogeneDB ID: | retro_mdom_341 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
Coordinates: | 1:221810928..221811287(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | UBE2A | ||
Ensembl ID: | ENSMODG00000010209 | ||
Aliases: | None | ||
Description: | ubiquitin-conjugating enzyme E2A [Source:HGNC Symbol;Acc:12472] |
Percent Identity: | 57.02 % |
Parental protein coverage: | 78.95 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 1 |
Parental | APSENNIMVWNAVIFGPEGTPFEDGTFKLTIEFTEEYPNKPPTVRFVSKMFHPNVYADGSICLDILQNRW |
A.SEN.IM....V..G..GTPFED..FKL..EFT.EY.NKP..VRF....FH...Y.DG.IC.DILQN.W | |
Retrocopy | ALSENSIMM*IRVVLGLKGTPFEDVIFKLRREFTKEYLNKPSIVRFAPRIFHTKIYEDGNICPDILQNHW |
Parental | SPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQ-ENKREYEKRVSAIVE |
.PTYDVSSI..S..SLL..P.PNS.ANS...QL.Q..NK.EY....S.I.. | |
Retrocopy | NPTYDVSSISISLRSLLNGPDPNSVANSWDTQL*Q<GNK*EYQAVTSEIAQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000001079 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000005098 | 2 retrocopies | |
Cavia porcellus | ENSCPOG00000011908 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000007060 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000003026 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000010209 | 1 retrocopy |
retro_mdom_341 ,
|
Monodelphis domestica | ENSMODG00000014209 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000016739 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000024335 | 1 retrocopy | |
Procavia capensis | ENSPCAG00000005045 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000012621 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000000888 | 1 retrocopy |