RetrogeneDB ID: | retro_mdom_503 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
Coordinates: | 1:75713689..75714090(-) | ||
Located in intron of: | ENSMODG00000004965 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | NME1 | ||
Ensembl ID: | ENSMODG00000028492 | ||
Aliases: | None | ||
Description: | nucleoside diphosphate kinase A [Source:RefSeq peptide;Acc:NP_001191452] |
Percent Identity: | 59.57 % |
Parental protein coverage: | 70.68 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 3 |
Parental | PGIMANSERTFIAIKPDGV---QRGLIG-EIVKRFEQKGFHLVALKFMQASEDLLREHYIDLKDRP-FYA |
P.IMAN...TFIAI..D.....Q.GL.G..I.K.FE.KGF.LVA.KF...SE..L..H...LK.RP.F.. | |
Retrocopy | PWIMANTKHTFIAIQLDSIQWGQWGLVG<DIIKHFEHKGFCLVAMKFCGDSEKHLNQHFVNLKNRP>FPL |
Parental | GLVKYMHSGPV-VAMVWEGLNVVKTGRMMVGETNPADSKPGTVRGDFCIQSGRNIIHGSDSVESAEKEIG |
.LVK...SGPV.VA.VWE.LN.VKTGRMM.G.TN..DSKPGT.RGD......RNI..GSDSV.SAEKEI. | |
Retrocopy | WLVKCINSGPV<VAIVWEVLNAVKTGRMMLGQTNSKDSKPGTIRGDI----SRNIMCGSDSVKSAEKEIN |
Parental | L |
L | |
Retrocopy | L |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .12 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
SRP007412_heart | 0 .20 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
SRP007412_testis | 0 .20 RPM | 0 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000004651 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000023628 | 7 retrocopies | |
Gorilla gorilla | ENSGGOG00000016526 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000012580 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000028492 | 1 retrocopy |
retro_mdom_503 ,
|
Mustela putorius furo | ENSMPUG00000015559 | 5 retrocopies | |
Mus musculus | ENSMUSG00000091228 | 3 retrocopies | |
Nomascus leucogenys | ENSNLEG00000007919 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000022135 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000009415 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000002693 | 3 retrocopies |