RetrogeneDB ID: | retro_cfam_1645 | ||
Retrocopy location | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 4:17226005..17226447(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NME1 | ||
| Ensembl ID: | ENSCAFG00000023628 | ||
| Aliases: | NME1, NM23-C1, NM23A | ||
| Description: | Canis lupus familiaris non-metastatic cells 1, protein (NM23A) expressed in (NME1), mRNA. [Source:RefSeq mRNA;Acc:NM_001024637] |
| Percent Identity: | 70.27 % |
| Parental protein coverage: | 96.71 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | RTFIAIKPDGVQRSLVGEIIKRFEQKGFRLIAMKLIQASEDLLKEHYIDLKDRPFFAGLVKYMQSGPVVA |
| RTFIAIKPD.VQ.SL.GEI.K.F..KGF.LIA.KLI.AS.DLLK.H.IDLK...FFA.L.K..QSG.VV. | |
| Retrocopy | RTFIAIKPDEVQHSLMGEITKPFKHKGFYLIATKLI*ASKDLLKKHDIDLKSHLFFANLMKKVQSGSVVV |
| Parental | MVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFQPEELVDYK-S |
| M.WEGLN.V.TGRVML....P.DSKP.TI.G.FCIQVG.NI.H..D..ESA.KEIGLWFQPEELVDY..S | |
| Retrocopy | MDWEGLNGVNTGRVMLSDSYPVDSKPETIHGFFCIQVGGNISHSKDFIESAKKEIGLWFQPEELVDYL>S |
| Parental | CAQNWIYE |
| .AQN.IYE | |
| Retrocopy | SAQN*IYE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .00 RPM | 94 .92 RPM |
| SRP017611_brain | 0 .00 RPM | 88 .05 RPM |
| SRP017611_kidney | 0 .00 RPM | 357 .59 RPM |
| SRP017611_liver | 0 .00 RPM | 60 .11 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000004651 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000019677 | 4 retrocopies | |
| Canis familiaris | ENSCAFG00000023628 | 7 retrocopies |
retro_cfam_117, retro_cfam_1645 , retro_cfam_37, retro_cfam_676, retro_cfam_69, retro_cfam_832, retro_cfam_96,
|
| Cavia porcellus | ENSCPOG00000008413 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000005563 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000016526 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000028492 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000015559 | 5 retrocopies | |
| Mus musculus | ENSMUSG00000091228 | 3 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000007919 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000022135 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000009415 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000002693 | 3 retrocopies |