RetrogeneDB ID: | retro_mmus_3081 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 7:119301254..119301673(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Gm20390 | ||
| Ensembl ID: | ENSMUSG00000091228 | ||
| Aliases: | None | ||
| Description: | predicted gene 20390 [Source:MGI Symbol;Acc:MGI:5141855] |
| Percent Identity: | 72.34 % |
| Parental protein coverage: | 52.43 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | PDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLN |
| PDGVQ..LVG.IIKR.E..GF.LVAMKFL..SEE.LK..YIDLK...FFPGLVKYMNS.PV.AMV.E.LN | |
| Retrocopy | PDGVQCRLVGGIIKRLE*EGFLLVAMKFLQTSEEYLKHRYIDLKGCSFFPGLVKYMNSAPVMAMVCERLN |
| Parental | VVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEK-EIHLWFKPEELIDYKSCAHDWVY |
| VVKTG...LG...PADSK.G.I.GDFCIQVGRN.IHGSDSV.S.EK....L.FKPEELIDYKSCAH.W.Y | |
| Retrocopy | VVKTGWMVLGGSSPADSKSGII*GDFCIQVGRNNIHGSDSVGSIEK<VVSLCFKPEELIDYKSCAHGWIY |
| Parental | E |
| . | |
| Retrocopy | K |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000004651 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000023628 | 7 retrocopies | |
| Cavia porcellus | ENSCPOG00000008413 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000005563 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000016526 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000028492 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000015559 | 5 retrocopies | |
| Mus musculus | ENSMUSG00000020857 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000024177 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000032478 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000091228 | 3 retrocopies |
retro_mmus_2712, retro_mmus_3081 , retro_mmus_581,
|
| Nomascus leucogenys | ENSNLEG00000007919 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000022135 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000009415 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000002693 | 3 retrocopies |