RetrogeneDB ID: | retro_mluc_1339 | ||
Retrocopy location | Organism: | Microbat (Myotis lucifugus) | |
| Coordinates: | GL429824:6041528..6041951(-) | ||
| Located in intron of: | ENSMLUG00000008596 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NDUFB9 | ||
| Ensembl ID: | ENSMLUG00000003765 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 74.83 % |
| Parental protein coverage: | 77.65 % |
| Number of stop codons detected: | 5 |
| Number of frameshifts detected: | 2 |
| Parental | MAFSAPAAYLTHQQKVLRLYKRALRHLESFCVHRDKYRYFACLMRARFDEHKNEKDMVKATRLLREAEEE |
| .AFS.P.AYL.HQ.KV..L.K.AL.HLES.CVHRDK..YFACLMRA.F..H.NEKDMVKAT.L.REAE.E | |
| Retrocopy | LAFSEPEAYLSHQ*KVS*LNKQALCHLESWCVHRDK*QYFACLMRAWFEDHRNEKDMVKATQLPREAEDE |
| Parental | FWHNQ-HPQPYIFPDSPGGTSYERYECYKVPEWCLDDWHPSEKAMY-PDYFAKREQWKKLRRE--SWERE |
| FW..Q.HPQP.IFPDSPGG.SYER.ECYKVPEWCLDDWHPSE.AM..PD.FAKR...KKL.RE..SWERE | |
| Retrocopy | FWPHQ>HPQPFIFPDSPGGASYERCECYKVPEWCLDDWHPSERAMI<PD*FAKRQHRKKLQRER*SWERE |
| Parental | VKQ |
| VKQ | |
| Retrocopy | VKQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000010022 | 1 retrocopy | |
| Ailuropoda melanoleuca | ENSAMEG00000015852 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000012818 | 1 retrocopy | |
| Equus caballus | ENSECAG00000018238 | 1 retrocopy | |
| Felis catus | ENSFCAG00000004678 | 1 retrocopy | |
| Homo sapiens | ENSG00000147684 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000015883 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000017481 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000003765 | 1 retrocopy |
retro_mluc_1339 ,
|
| Macaca mulatta | ENSMMUG00000015493 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000001831 | 3 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000005484 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000030772 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000018869 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000020569 | 2 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000009153 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000021955 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000006895 | 3 retrocopies |