RetrogeneDB ID: | retro_pabe_3366 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 8:117861385..117861755(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | NDUFB9 | ||
Ensembl ID: | ENSPPYG00000018869 | ||
Aliases: | None | ||
Description: | NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 9, 22kDa [Source:HGNC Symbol;Acc:7704] |
Percent Identity: | 61.11 % |
Parental protein coverage: | 68. % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 2 |
Parental | KNEKDMARA-QLLKEAEEEFWYRQHPQPYIF-PDSPGGTSYERYDC-KVPEWCLDDWHPSEK-MYPDYFA |
.NEKD..R..QLL....EEFW..Q.PQP.IF.P.....TS.ERY.C.KVPEW.LDDW.PSEK.M.PDY.A | |
Retrocopy | QNEKDIIRTTQLLRGTDEEFWHCQPPQPCIF<PCCLESTSNERYKCYKVPEWFLDDWLPSEKAMHPDYCA |
Parental | KREQWK-KQRESWR-EVKQLQEETPPGGPLTE-ALPPARKEGDLPPLWWYIVTRPR |
KR.QWK...RESW..EVKQLQEE.PPGGP....AL.P..KE....PL...IVTR.R | |
Retrocopy | KRQQWK*LWRESWE*EVKQLQEEIPPGGPKIK<ALLPSGKESNFLPLQLCIVTRLR |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 6 .03 RPM |
SRP007412_cerebellum | 0 .00 RPM | 3 .65 RPM |
SRP007412_heart | 0 .00 RPM | 10 .51 RPM |
SRP007412_kidney | 0 .00 RPM | 14 .92 RPM |
SRP007412_liver | 0 .00 RPM | 8 .60 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_4112 |
Pan troglodytes | retro_ptro_2791 |
Gorilla gorilla | retro_ggor_2759 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Anolis carolinensis | ENSACAG00000010022 | 1 retrocopy | |
Ailuropoda melanoleuca | ENSAMEG00000015852 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000012818 | 1 retrocopy | |
Equus caballus | ENSECAG00000018238 | 1 retrocopy | |
Felis catus | ENSFCAG00000004678 | 1 retrocopy | |
Homo sapiens | ENSG00000147684 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000015883 | 2 retrocopies | |
Microcebus murinus | ENSMICG00000017481 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000003765 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000015493 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000001831 | 3 retrocopies | |
Nomascus leucogenys | ENSNLEG00000005484 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000030772 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000018869 | 3 retrocopies |
retro_pabe_2643, retro_pabe_3182, retro_pabe_3366 ,
|
Pan troglodytes | ENSPTRG00000020569 | 2 retrocopies | |
Pteropus vampyrus | ENSPVAG00000009153 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000021955 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000006895 | 3 retrocopies |