RetrogeneDB ID: | retro_mmul_2353 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 8:82993124..82993496(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | OCIAD2 | ||
Ensembl ID: | ENSMMUG00000014869 | ||
Aliases: | None | ||
Description: | OCIA domain-containing protein 2 [Source:RefSeq peptide;Acc:NP_001253920] |
Percent Identity: | 80.65 % |
Parental protein coverage: | 80.52 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | KLHIHRAEISKIMRECQEESFWKRALPFSLVSMLVTQGLVYQGYLAANPRFGSLPKVALAGLLGFGLGKV |
KLHIHR.EIS.I.R.CQEESFWKRALPFS.VSM.VTQGL..Q.YLAANPRFGSLPKV.L.G.LGFGLGKV | |
Retrocopy | KLHIHRGEISTIIRGCQEESFWKRALPFSPVSMFVTQGLFCQRYLAANPRFGSLPKVTLVGILGFGLGKV |
Parental | SYIGVCQSKFYFFEDQLRGAGFGPQHNRHCLLTCEECKIKHGLSEKGDSQPSAS |
SY..VCQSKF.FFEDQL.GAGFGPQ.NRH.LLTCEEC..KH..SEKG.SQP.AS | |
Retrocopy | SYMRVCQSKFHFFEDQLHGAGFGPQQNRH*LLTCEECNMKHRFSEKGSSQPLAS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 5 .60 RPM |
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 6 .90 RPM |
SRP007412_cerebellum | 0 .00 RPM | 6 .01 RPM |
SRP007412_heart | 0 .00 RPM | 1 .65 RPM |
SRP007412_kidney | 0 .12 RPM | 9 .15 RPM |
SRP007412_liver | 0 .00 RPM | 12 .86 RPM |
SRP007412_testis | 0 .04 RPM | 0 .19 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_4082 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000018637 | 1 retrocopy | |
Erinaceus europaeus | ENSEEUG00000006759 | 1 retrocopy | |
Homo sapiens | ENSG00000145247 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000013778 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000006147 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000014869 | 1 retrocopy |
retro_mmul_2353 ,
|
Monodelphis domestica | ENSMODG00000025531 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000017430 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000007907 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000011039 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000014722 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000016048 | 1 retrocopy | |
Vicugna pacos | ENSVPAG00000011765 | 1 retrocopy |