RetrogeneDB ID: | retro_mmul_422 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 1:142960128..142960539(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MMU.2633 | ||
| Ensembl ID: | ENSMMUG00000005645 | ||
| Aliases: | None | ||
| Description: | nuclear ubiquitous casein and cyclin-dependent kinases substrate [Source:RefSeq peptide;Acc:NP_001253410] |
| Percent Identity: | 72.97 % |
| Parental protein coverage: | 59.26 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 4 |
| Parental | YRNRKV-VDYSQFQESDDADEDYGRDSGP-PTKKIRSSPREAKNKRRSGKNSQEDSEDSEDKDVKTKKDD |
| .RNRKV.VD.SQFQESDD.DE....DSGP.P..K....P...K..RRSGKNSQEDSEDSE.KD.KTKKDD | |
| Retrocopy | FRNRKV>VDFSQFQESDDTDE----DSGP>PLRKFDHLP*KLKI-RRSGKNSQEDSEDSEEKDLKTKKDD |
| Parental | SHSAEDSEDEKEDHKNVRQQ-RQAASKAASKQREMLMEDV-GSEEEQEEEDEAPFQEKDSGSDEDFLMED |
| .HSAED.EDE.EDHKNV.Q...QAASKAAS.QRE.L.EDV.G.EEEQ.EEDEAPFQE..SGS.EDFLMED | |
| Retrocopy | FHSAEDNEDENEDHKNVHQH<QQAASKAASEQRETLTEDV<GREEEQ-EEDEAPFQE-NSGSNEDFLMED |
| Parental | DDDSDYGS |
| DDDSD.G. | |
| Retrocopy | DDDSD*GN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .11 RPM | 94 .68 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 64 .81 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 96 .99 RPM |
| SRP007412_heart | 0 .00 RPM | 64 .07 RPM |
| SRP007412_kidney | 0 .00 RPM | 61 .74 RPM |
| SRP007412_liver | 0 .00 RPM | 25 .41 RPM |
| SRP007412_testis | 0 .00 RPM | 40 .97 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_521 |
| Pan troglodytes | retro_ptro_389 |
| Gorilla gorilla | retro_ggor_480 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000012950 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000008001 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000001855 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000017212 | 2 retrocopies | |
| Dipodomys ordii | ENSDORG00000003183 | 1 retrocopy | |
| Homo sapiens | ENSG00000069275 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000026655 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000007829 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000005645 | 1 retrocopy |
retro_mmul_422 ,
|
| Monodelphis domestica | ENSMODG00000001832 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000014564 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000001904 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000047287 | 2 retrocopies | |
| Tupaia belangeri | ENSTBEG00000015641 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000000910 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000003751 | 1 retrocopy |