RetrogeneDB ID: | retro_mmul_422 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 1:142960128..142960539(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MMU.2633 | ||
Ensembl ID: | ENSMMUG00000005645 | ||
Aliases: | None | ||
Description: | nuclear ubiquitous casein and cyclin-dependent kinases substrate [Source:RefSeq peptide;Acc:NP_001253410] |
Percent Identity: | 72.97 % |
Parental protein coverage: | 59.26 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 4 |
Parental | YRNRKV-VDYSQFQESDDADEDYGRDSGP-PTKKIRSSPREAKNKRRSGKNSQEDSEDSEDKDVKTKKDD |
.RNRKV.VD.SQFQESDD.DE....DSGP.P..K....P...K..RRSGKNSQEDSEDSE.KD.KTKKDD | |
Retrocopy | FRNRKV>VDFSQFQESDDTDE----DSGP>PLRKFDHLP*KLKI-RRSGKNSQEDSEDSEEKDLKTKKDD |
Parental | SHSAEDSEDEKEDHKNVRQQ-RQAASKAASKQREMLMEDV-GSEEEQEEEDEAPFQEKDSGSDEDFLMED |
.HSAED.EDE.EDHKNV.Q...QAASKAAS.QRE.L.EDV.G.EEEQ.EEDEAPFQE..SGS.EDFLMED | |
Retrocopy | FHSAEDNEDENEDHKNVHQH<QQAASKAASEQRETLTEDV<GREEEQ-EEDEAPFQE-NSGSNEDFLMED |
Parental | DDDSDYGS |
DDDSD.G. | |
Retrocopy | DDDSD*GN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .11 RPM | 94 .68 RPM |
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 64 .81 RPM |
SRP007412_cerebellum | 0 .00 RPM | 96 .99 RPM |
SRP007412_heart | 0 .00 RPM | 64 .07 RPM |
SRP007412_kidney | 0 .00 RPM | 61 .74 RPM |
SRP007412_liver | 0 .00 RPM | 25 .41 RPM |
SRP007412_testis | 0 .00 RPM | 40 .97 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_521 |
Pan troglodytes | retro_ptro_389 |
Gorilla gorilla | retro_ggor_480 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000012950 | 1 retrocopy | |
Bos taurus | ENSBTAG00000008001 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000001855 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000017212 | 2 retrocopies | |
Dipodomys ordii | ENSDORG00000003183 | 1 retrocopy | |
Homo sapiens | ENSG00000069275 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000026655 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000007829 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000005645 | 1 retrocopy |
retro_mmul_422 ,
|
Monodelphis domestica | ENSMODG00000001832 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000014564 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000001904 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000047287 | 2 retrocopies | |
Tupaia belangeri | ENSTBEG00000015641 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000000910 | 1 retrocopy | |
Vicugna pacos | ENSVPAG00000003751 | 1 retrocopy |