RetrogeneDB ID: | retro_mmul_743 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 1099214780579:0..370(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MMU.17900 | ||
| Ensembl ID: | ENSMMUG00000007453 | ||
| Aliases: | None | ||
| Description: | ADP-ribosylation factor-like protein 5B [Source:RefSeq peptide;Acc:NP_001180408] |
| Percent Identity: | 59.23 % |
| Parental protein coverage: | 71.51 % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected: | 2 |
| Parental | VEEIVVKNTHFLMWDIGG-QESLR-SSWNTYYSNTEFIILVVDSIDRERLAITKEELYRMLAHEDLRKAA |
| V.E.V..NT.FL.WDIG..QESL..SSWNTYY.NTEF....V....R..L...K.....ML..EDLRKA. | |
| Retrocopy | VQERVINNTRFLTWDIGS<QESLG<SSWNTYYTNTEFV--IVWEVQRGFL*LEKNS--KMLVLEDLRKA* |
| Parental | VLIFANKQDMKGCMTAAEISKYLTLSSIKDHPWHIQSCCALTGEGLCQGLEWMTSRIGVR |
| .L..ANKQD.K.CMT.AEI.K.L.L.S.KDH.WHIQ..CALTGEGLC..LEWM.S....R | |
| Retrocopy | LLSLANKQDVKECMTVAEIGKFLKLPSVKDHQWHIQA*CALTGEGLCRRLEWMMS*LKIR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 10 .08 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 7 .46 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 12 .27 RPM |
| SRP007412_heart | 0 .00 RPM | 2 .36 RPM |
| SRP007412_kidney | 0 .00 RPM | 3 .64 RPM |
| SRP007412_liver | 0 .00 RPM | 1 .78 RPM |
| SRP007412_testis | 0 .00 RPM | 6 .22 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Cavia porcellus | ENSCPOG00000005856 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000007453 | 3 retrocopies |
retro_mmul_614, retro_mmul_726, retro_mmul_743 ,
|
| Macaca mulatta | ENSMMUG00000010521 | 5 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000014876 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000027859 | 1 retrocopy |