RetrogeneDB ID: | retro_mmul_842 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 11:8601649..8601931(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MMU.333 | ||
| Ensembl ID: | ENSMMUG00000007579 | ||
| Aliases: | None | ||
| Description: | suppressor of Ty 4 homolog 1 [Source:RefSeq peptide;Acc:NP_001247588] |
| Percent Identity: | 87.23 % |
| Parental protein coverage: | 80.34 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | TIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRL |
| TIDQFEYDGCD.CDA.LQMKGN.EMVYDCTSSSFD.IIAMMSP.DSWVSK.QRV.NFKPGVY.VSVTGRL | |
| Retrocopy | TIDQFEYDGCDYCDANLQMKGN*EMVYDCTSSSFDRIIAMMSPDDSWVSK*QRVNNFKPGVYVVSVTGRL |
| Parental | PQGIVRELKSRGVAYKSRDTAIKT |
| PQ..VRELK.RGVAYKSRDTA.KT | |
| Retrocopy | PQRTVRELKRRGVAYKSRDTAMKT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 16 .47 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 22 .37 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 14 .98 RPM |
| SRP007412_heart | 0 .00 RPM | 11 .60 RPM |
| SRP007412_kidney | 0 .00 RPM | 11 .62 RPM |
| SRP007412_liver | 0 .00 RPM | 12 .07 RPM |
| SRP007412_testis | 0 .23 RPM | 22 .88 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000017524 | 2 retrocopies | |
| Homo sapiens | ENSG00000213246 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000007232 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000010164 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000025583 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000007579 | 2 retrocopies |
retro_mmul_1005, retro_mmul_842 ,
|
| Mus musculus | ENSMUSG00000020485 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000008159 | 3 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000025823 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000008233 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000009451 | 2 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000002320 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000007845 | 3 retrocopies |