RetrogeneDB ID: | retro_mmur_55 | ||
Retrocopylocation | Organism: | Mouse Lemur (Microcebus murinus) | |
Coordinates: | GeneScaffold_1010:52429..52648(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPS21 | ||
Ensembl ID: | ENSMICG00000012997 | ||
Aliases: | None | ||
Description: | ribosomal protein S21 [Source:HGNC Symbol;Acc:10409] |
Percent Identity: | 51.35 % |
Parental protein coverage: | 77.89 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MQNDAGEFVDLYVPRKCSASNRIIGAKDHASIQMNAGRSTRLQADSTANLKPMPSVGPFAGWVSQMIPFS |
.QNDAGE..DL..PRKCS..N.I.....H.S.QMNA.R.......STA......S.G.FA...SQMIP.S | |
Retrocopy | VQNDAGELMDLDAPRKCSVDNCIPSGESHTSTQMNA-RQRQVRTGSTARSESALSAGMFAARGSQMIPIS |
Parental | DWPR |
.WPR | |
Retrocopy | AWPR |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |