RetrogeneDB ID: | retro_cjac_629 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 1:154194319..154194547(-) | ||
Located in intron of: | ENSCJAG00000017434 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSCJAG00000014195 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 68.83 % |
Parental protein coverage: | 92.77 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | EFVDLYVPRKCSASNRIIGAKDHASIQMNVAEVDKVTGRFNGQFKTYAICGAIRRMGESDDSILRLAKAD |
EFVDLY...KCS..N.I..AKDH.SIQMN.A..D.VTGRFNGQFKTY..CG...RMGESDDSIL.L.K.D | |
Retrocopy | EFVDLYMRWKCSTCNCIMVAKDHVSIQMNLAKIDEVTGRFNGQFKTYIVCGGFLRMGESDDSIL*LVKSD |
Parental | GIVSKNF |
.I.S.NF | |
Retrocopy | SI-SNNF |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .13 RPM | 29 .58 RPM |
SRP051959_heart | 0 .05 RPM | 27 .56 RPM |
SRP051959_kidney | 0 .00 RPM | 41 .02 RPM |
SRP051959_liver | 0 .00 RPM | 61 .86 RPM |
SRP051959_lung | 0 .05 RPM | 31 .58 RPM |
SRP051959_lymph_node | 0 .05 RPM | 55 .02 RPM |
SRP051959_skeletal_muscle | 0 .59 RPM | 82 .02 RPM |
SRP051959_spleen | 0 .00 RPM | 41 .13 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_4303 |
Gorilla gorilla | retro_ggor_2875 |
Pongo abelii | retro_pabe_3503 |
Macaca mulatta | retro_mmul_1138 |