RetrogeneDB ID: | retro_pabe_1562 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 18:59213579..59213738(+) | ||
Located in intron of: | ENSPPYG00000009135 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSPPYG00000011205 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 73.58 % |
Parental protein coverage: | 63.86 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | AKDHASIQMNVAEVDKVTGRFNGQFKTYAICGAIRRMGESDDSILRLAKADGI |
A.DHAS.Q....E.DKVTGRFN.QFKTY.I..AIRRMGESD.SILRLAKA..I | |
Retrocopy | AEDHASMQKDMGEIDKVTGRFNDQFKTYVIQRAIRRMGESDYSILRLAKANSI |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .24 RPM | 0 .00 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1883 |
Gorilla gorilla | retro_ggor_1380 |
Macaca mulatta | retro_mmul_1331 |