RetrogeneDB ID: | retro_lcha_124 | ||
Retrocopylocation | Organism: | Coelacanth (Latimeria chalumnae) | |
Coordinates: | JH130455.1:108293..108464(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | rps21 (1 of 2) | ||
Ensembl ID: | ENSLACG00000012753 | ||
Aliases: | None | ||
Description: | ribosomal protein S21 [Source:ZFIN;Acc:ZDB-GENE-040426-1102] |
Percent Identity: | 63.33 % |
Parental protein coverage: | 69.88 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 2 |
Parental | MQNDA-GEFVDLYVPRKCSASNRIIGAKDHASIQLNLAEVDRLTGRFNGQFKT-YAICGA |
MQND..G...DLYVP..CS.SNRI...KDH.S.QLNLAEVD..TGR..G..KT...ICGA | |
Retrocopy | MQNDT>GNYLDLYVPHNCSTSNRIVDFKDHISVQLNLAEVDKRTGRLIG-YKT<LVICGA |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
DRP000627_gill | 0 .00 RPM | 314 .62 RPM |
DRP000627_kidney | 0 .00 RPM | 459 .90 RPM |
DRP000627_pectoral_fin | 0 .00 RPM | 593 .06 RPM |
DRP000627_pelvic_fin | 0 .00 RPM | 478 .90 RPM |
DRP000627_pharynx | 0 .00 RPM | 186 .07 RPM |
DRP000627_tail_muscle | 0 .00 RPM | 121 .75 RPM |